PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0124s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 837aa    MW: 91705.2 Da    PI: 6.2763
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0124s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-181775357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         k  ++t+eq+e+Le+l++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  Bostr.0124s0004.1.p 17 KYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 75
                         5679*****************************************************97 PP

2START167.11.2e-521613692205
                          HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT..E CS
                START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg..g 89 
                          +aee+++e+++ka+ ++  W +++ +++g++++ +++ s++++g a+ra+g+v  +++  v+e+++d++ W + ++++++++v+ ++  g
  Bostr.0124s0004.1.p 161 IAEETLAEFISKATGTAVEWIQMPGMKPGPDSIGIIAISHGCTGVAARACGLVGLEPT-RVAEIVKDRPSWFRECRAVDVMNVLPTAngG 249
                          7899******************************************************.7777777777****************9999* PP

                          EEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
                START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                          +++l +++l+a+++l+p Rdf+ +Ry+  l++g++v++++S+ s+q+ p+    +++vRae+lpSg+li+p+++g+s +++v+h+dl++ 
  Bostr.0124s0004.1.p 250 TIELLYMQLYAPTTLAPpRDFWLLRYTSVLEDGSLVVCERSLKSTQNGPSmplVQNFVRAEMLPSGYLIRPCDGGGSIIHIVDHMDLEAC 339
                          *************************************************999999*********************************** PP

                          XXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 176 lphwllrslvksglaegaktwvatlqrqce 205
                          +++++lr+l++s  + ++kt++a+l+++++
  Bostr.0124s0004.1.p 340 SVPEVLRPLYESPKVLAQKTTMAALRQLKQ 369
                          **************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.2E-151480IPR001356Homeobox domain
SuperFamilySSF466894.71E-171680IPR009057Homeodomain-like
CDDcd000869.27E-171777No hitNo description
PfamPF000462.9E-161875IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-181975IPR009057Homeodomain-like
PROSITE profilePS5007115.2732076IPR001356Homeobox domain
CDDcd146861.29E-669108No hitNo description
PROSITE profilePS5084825.363151379IPR002913START domain
CDDcd088751.38E-73155371No hitNo description
Gene3DG3DSA:3.30.530.202.0E-20160346IPR023393START-like domain
SuperFamilySSF559611.65E-35160372No hitNo description
SMARTSM002342.4E-36160370IPR002913START domain
PfamPF018523.2E-50161369IPR002913START domain
PfamPF086708.7E-52693835IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010014Biological Processmeristem initiation
GO:0010075Biological Processregulation of meristem growth
GO:0010087Biological Processphloem or xylem histogenesis
GO:0048263Biological Processdetermination of dorsal identity
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MAMSCKDGKL GCLDNGKYVR YTPEQVEALE RLYHECPKPS SIRRQQLIRE CPILSNIEPK  60
QIKVWFQNRR CREKQRKEAS RLQAVNRKLT AMNKLLMEEN DRLQKQVSQL VHENSYFRQN  120
THNPSLPAKD TSCESVVTSG QHELASQNPQ RDASPAGLLS IAEETLAEFI SKATGTAVEW  180
IQMPGMKPGP DSIGIIAISH GCTGVAARAC GLVGLEPTRV AEIVKDRPSW FRECRAVDVM  240
NVLPTANGGT IELLYMQLYA PTTLAPPRDF WLLRYTSVLE DGSLVVCERS LKSTQNGPSM  300
PLVQNFVRAE MLPSGYLIRP CDGGGSIIHI VDHMDLEACS VPEVLRPLYE SPKVLAQKTT  360
MAALRQLKQI AQEVTQTNSS VNGWGRRPAA LRALSQRLSR GFNEAVNGFT DEGWSVIGDS  420
MDDVTITVNS SPDKLMGLNL TFSNGFAPVS SVVLCAKASM LLQNVPPAIL LRFLREHRSE  480
WADNNIDAYL AAAVKVGPCS ARVGGFGGQV ILPLAHTIEH EEFMEVIKLE GLGHSPEDAI  540
VPRDIFLLQL CSGMDESAVG TCAELIFAPI DASFADDAPL LPSGFRIIPL DSAKEVSSPN  600
RTLDLASALE IGSAGTKAST DQSGNSTCAR SVMTIAFEFG IESHMQEHVA SMARQYVRGI  660
ISSVQRVALA LSPSHISSQV GLRTPLGTPE AQTLARWICQ SYRGYMGVEL LKSISEGNES  720
ILKNLWHHTD AIICCSMKAL PVFTFANQAG LDMLETTLVA LQDISLEKIF DDNGRKTLCS  780
EFPQIMQQGF ACLQGGICLS SMGRPVSYER AVAWKVLNEE ENAHCICFVF ISWSFV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00200DAPTransfer from AT1G52150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4394490.0AJ439449.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein (ATHB-15 gene).
GenBankAY0605560.0AY060556.1 Arabidopsis thaliana At1g52150/F5F19_21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010479714.10.0PREDICTED: homeobox-leucine zipper protein ATHB-15
SwissprotQ9ZU110.0ATB15_ARATH; Homeobox-leucine zipper protein ATHB-15
TrEMBLD7KIP00.0D7KIP0_ARALL; ATHB-15
STRINGfgenesh1_pm.C_scaffold_10033350.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20222678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.10.0HD-ZIP family protein